PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRAES3BF066000010CFD_t1
Common NameTRAES_3BF066000010CFD_c1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family Dof
Protein Properties Length: 347aa    MW: 36891.8 Da    PI: 7.3969
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRAES3BF066000010CFD_t1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1146.7e-36105161460
                   zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                              + l+cprCdstntkfCy+nnysl qPr+fC++CrryWt+GG+lrnvPvGgg r++ k
  TRAES3BF066000010CFD_t1 105 SGLNCPRCDSTNTKFCYFNNYSLIQPRHFCRSCRRYWTRGGTLRNVPVGGGYRRHAK 161
                              5689***********************************************999866 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-3293161IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.323107161IPR003851Zinc finger, Dof-type
PfamPF027015.7E-31107161IPR003851Zinc finger, Dof-type
PROSITE patternPS013610109145IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MIFLPAFLDS SNFWNTDHNQ LQLQQIGTNT QSTTTPSPAG PGDGGCNNNN EEGFMATAGA  60
GSVAGGGGND GCSGAGDGDC SKSGNSKSMS MSERAQLAGL PQPVSGLNCP RCDSTNTKFC  120
YFNNYSLIQP RHFCRSCRRY WTRGGTLRNV PVGGGYRRHA KRRGKPNVVS NTSRSTAVGT  180
SSVTTTMSSN TTYATGTGPV PPGLQGPMLG SAPSHDSQFA HRIDPASLGL SFPDRLLFAD  240
GGSCAVDGCA QHHHNHAHWY GMEQWSAAQI GSFPFMHAMD HQMSGAMPIT MATMQGMFHL  300
GLQSVGGGKD DNRGGHLLHH KQQDYSSSRG MYGDMVNGEL DQDLFLD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A080YUV20.0A0A080YUV2_WHEAT; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.11e-37OBF-binding protein 3
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]